PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 339aa    MW: 38123.3 Da    PI: 7.1777
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1054e-33165223159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK vk+++fprsYYrCt+a+C vkk+vers +d+++v++tYeg+H+h+
  XP_009621692.1 165 LDDGYRWRKYGQKAVKNNPFPRSYYRCTTASCGVKKRVERSIKDTSIVVTTYEGTHTHP 223
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.9E-34150225IPR003657WRKY domain
SuperFamilySSF1182904.71E-29157225IPR003657WRKY domain
PROSITE profilePS5081131.227160225IPR003657WRKY domain
SMARTSM007741.1E-37165224IPR003657WRKY domain
PfamPF031061.8E-26166223IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEKENKLKAE TSLENQTFSN QIPTSFSLPN IFDMLYETEK DSLDTIFGAH LLDYYNTTTT  60
PSIFDLLQTP LQTPLLIPPQ SLFTSISTTS TFQESSPVTP NSLSISSSSL EAADDDQQSN  120
TVKQKNEEQD QDKYKKQLKP KKKNVQKRQR EPRFAFMTKS EIDHLDDGYR WRKYGQKAVK  180
NNPFPRSYYR CTTASCGVKK RVERSIKDTS IVVTTYEGTH THPCPMTLRG STGVLPRTTA  240
YYGGAIGGGN GGGGTCSNSS LSIPQLQYYQ EQEQQTVLHF PTTTSHLNNF TVGYTSLFST  300
NSLEERRFSP SPYSSSLTGD DGLLHDMVSS QIRRDTKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-28155226778Probable WRKY transcription factor 4
2lex_A1e-28155226778Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621692.10.0PREDICTED: probable WRKY transcription factor 48
RefseqXP_016515350.10.0PREDICTED: probable WRKY transcription factor 48
TrEMBLD7SYJ21e-83D7SYJ2_VITVI; Putative uncharacterized protein
STRINGVIT_05s0077g00730.t013e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13092479
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.14e-44WRKY DNA-binding protein 48